General Information

  • ID:  hor004650
  • Uniprot ID:  Q9FZE4
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 9
  • Gene name:  CLE9
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE9p]: Mostly expressed in leaves, flowers, stems and apex, and, to a lower extent, in seedlings, roots, siliques and pollen.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  SSTVVDEGNRTSRNFRYRTHRFVPRFNHHPYHVTPHRSCDSFIRPYARSMCIELQRIHRSSRKQPLLSPPPPEIDPRYGVDKRLVPSGPNPLHN
  • Length:  94(27-120)
  • Propeptide:  MTMTHLNRLILISLLFVSLLLKSSTASSTVVDEGNRTSRNFRYRTHRFVPRFNHHPYHVTPHRSCDSFIRPYARSMCIELQRIHRSSRKQPLLSPPPPEIDPRYGVDKRLVPSGPNPLHN
  • Signal peptide:  MTMTHLNRLILISLLFVSLLLKSSTA
  • Modification:  T86 Hydroxyproline;T89 Hydroxyproline
  • Glycosylation:  T9 N-linked (GlcNAc...) asparagine;T89 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9FZE4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004650_AF2.pdbhor004650_ESM.pdb

Physical Information

Mass: 1272642 Formula: C486H757N159O134S3
Absent amino acids: W Common amino acids: RP
pI: 11.27 Basic residues: 23
Polar residues: 28 Hydrophobic residues: 20
Hydrophobicity: -104.36 Boman Index: -30705
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 56.91
Instability Index: 7371.91 Extinction Coefficient cystines: 6085
Absorbance 280nm: 65.43

Literature

  • PubMed ID:  30518839
  • Title:  The CLE9/10 Secretory Peptide Regulates Stomatal and Vascular Development Through Distinct Receptors